Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRAP1 Rabbit pAb (APR23838N)

Product Specifications

Background

Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DRAP1 Rabbit pAb (APR23838N) .

Synonyms

NC2-alpha; DRAP1

Gene ID

10589

UniProt

Q14919

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 32-38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10589

Uniprot URL

https://www.uniprot.org/uniprot/Q14919

AA Sequence

LKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Got1 Recombinant Protein
PROTP05201-20ug 20 µg

Mouse Got1 Recombinant Protein

Ask
View Details
Lentiviral human KLHDC1 shRNA (UAS) - Lentiviral human KLHDC1 shRNA (UAS, GFP) plasmid
GTR15327241 1 Vial

Lentiviral human KLHDC1 shRNA (UAS) - Lentiviral human KLHDC1 shRNA (UAS, GFP) plasmid

Ask
View Details
STARD13, ID (STARD13, DLC2, GT650, StAR-related lipid transfer protein 13, 46H23.2, Deleted in liver cancer 2 protein, Rho GTPase-activating protein, START domain-containing protein 13) (AP)
MBS6351752-01 0.2 mL

STARD13, ID (STARD13, DLC2, GT650, StAR-related lipid transfer protein 13, 46H23.2, Deleted in liver cancer 2 protein, Rho GTPase-activating protein, START domain-containing protein 13) (AP)

Ask
View Details
STARD13, ID (STARD13, DLC2, GT650, StAR-related lipid transfer protein 13, 46H23.2, Deleted in liver cancer 2 protein, Rho GTPase-activating protein, START domain-containing protein 13) (AP)
MBS6351752-02 5x 0.2 mL

STARD13, ID (STARD13, DLC2, GT650, StAR-related lipid transfer protein 13, 46H23.2, Deleted in liver cancer 2 protein, Rho GTPase-activating protein, START domain-containing protein 13) (AP)

Ask
View Details
Mouse Polyclonal NRG4 Antibody
H00145957-B01P 0.05 mg

Mouse Polyclonal NRG4 Antibody

Ask
View Details
Bovine RBFOX1/RNA Binding Protein Fox-1 Homolog 1 ELISA Kit
MBS2890618-01 48 Well

Bovine RBFOX1/RNA Binding Protein Fox-1 Homolog 1 ELISA Kit

Ask
View Details