Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM7 Rabbit pAb (APR23830N)

Product Specifications

Background

RNA-binding subunit of the trimeric nuclear exosome targeting (NEXT complex, a complex that functions as an RNA exosome cofactor that directs a subset of non-coding short-lived RNAs for exosomal degradation. NEXT is involved in surveillance and turnover of aberrant transcripts and non-coding RNAs. Binds preferentially polyuridine sequences and associates with newly synthesized RNAs, including pre-mRNAs and short-lived exosome substrates such as promoter upstream transcripts (PROMPTs, enhancer RNAs (eRNAs, and 3'-extended products from small nuclear RNAs (snRNAs. Participates in several biological processes including DNA damage response (DDR and stress response. During stress response, activation of the p38MAPK-MK2 pathway decreases RBM7-RNA-binding and subsequently the RNA exosome degradation activities, thereby modulating the turnover of non-coding transcriptome. Participates in DNA damage response (DDR, through its interaction with MEPCE and LARP7, the core subunits of 7SK snRNP complex, that release the positive transcription elongation factor b (P-TEFb complex from the 7SK snRNP. In turn, activation of P-TEFb complex induces the transcription of P-TEFb-dependent DDR genes to promote cell viability.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBM7 Rabbit pAb (APR23830N) .

Synonyms

RBM7

Gene ID

10179

UniProt

Q9Y580

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10179

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y580

AA Sequence

MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tissue Total RNA, Breast, left
CR561915 5 µg

Tissue Total RNA, Breast, left

Ask
View Details
Human PCSK9 Protein, His Tag
KMPH5982 10 µg

Human PCSK9 Protein, His Tag

Ask
View Details
Magic™ Membrane Protein Human OPN1SW (Opsin 1, shoRoom Temperature wave sensitive) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX2880K Each

Magic™ Membrane Protein Human OPN1SW (Opsin 1, shoRoom Temperature wave sensitive) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Ask
View Details
Rat Fatty acid-binding protein ELISA Kit
MBS724384-01 48 Well

Rat Fatty acid-binding protein ELISA Kit

Ask
View Details
Rat Fatty acid-binding protein ELISA Kit
MBS724384-02 96 Well

Rat Fatty acid-binding protein ELISA Kit

Ask
View Details
Rat Fatty acid-binding protein ELISA Kit
MBS724384-03 5x 96 Well

Rat Fatty acid-binding protein ELISA Kit

Ask
View Details