Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF144A Rabbit pAb (APR23822N)

Product Specifications

Background

This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Mar 2017]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF144A Rabbit pAb (APR23822N) .

Synonyms

RNF144; UBCE7IP4; hUIP4; RNF144A

Gene ID

9781

UniProt

P50876

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9781

Uniprot URL

https://www.uniprot.org/uniprot/P50876

AA Sequence

ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL
BNC041815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF488A conjugate, 0.1mg/mL
BNC880452-500 1x 500 µL

Vimentin (VM452), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS809196 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Recombinant KYNU Monoclonal Antibody
AN300078P 100 µL

Recombinant KYNU Monoclonal Antibody

Sign In for Pricing
View Details
St6gal1 Mouse Gene Knockout Kit (CRISPR)
KN516803 1 Kit

St6gal1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTC23 (NM_001040658) Human Over-expression Lysate
LC421799 20 µg

TTC23 (NM_001040658) Human Over-expression Lysate

Sign In for Pricing
View Details