Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF144A Rabbit pAb (APR23822N)

Product Specifications

Background

This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Mar 2017]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF144A Rabbit pAb (APR23822N) .

Synonyms

RNF144; UBCE7IP4; hUIP4; RNF144A

Gene ID

9781

UniProt

P50876

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9781

Uniprot URL

https://www.uniprot.org/uniprot/P50876

AA Sequence

ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VI (COL6A2) (C-term) Rabbit Polyclonal Antibody
AP51018PU-N 400 µL

Collagen VI (COL6A2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI7H4]
CF812669 100 µg

ZNF480 Mouse Monoclonal Antibody [Clone ID: OTI7H4]

Sign In for Pricing
View Details
Zinc Alpha 2 Glycoprotein (AZGP1) (NM_001185) Human Over-expression Lysate
LY420084 100 µg

Zinc Alpha 2 Glycoprotein (AZGP1) (NM_001185) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C9ORF46 (PLGRKT) activation kit by CRISPRa
GA111017 1 Kit

Human C9ORF46 (PLGRKT) activation kit by CRISPRa

Sign In for Pricing
View Details
KDM2B (NM_001005366) Human Over-expression Lysate
LY423701 100 µg

KDM2B (NM_001005366) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human EGFR/ErbB1 Protein (Fc Tag)
PKSH032396-01 10 µg

Recombinant Human EGFR/ErbB1 Protein (Fc Tag)

Sign In for Pricing
View Details