Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX11A Rabbit pAb (APR23806N)

Product Specifications

Background

This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintenance and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PEX11A Rabbit pAb (APR23806N) .

Synonyms

PEX11-ALPHA; PMP28; hsPEX11p; PEX11A

Gene ID

8800

UniProt

O75192

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8800

Uniprot URL

https://www.uniprot.org/uniprot/O75192

AA Sequence

LTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CCR1 Antibody (643854) [DyLight 488]
FAB5986K 0.1 mL

Rat Monoclonal CCR1 Antibody (643854) [DyLight 488]

Sign In for Pricing
View Details
DIABLO (Second Mitochondrial Activator of Cell Death, SMAC, DFNA64) (APC)
MBS6414100-01 0.1 mL

DIABLO (Second Mitochondrial Activator of Cell Death, SMAC, DFNA64) (APC)

Sign In for Pricing
View Details
DIABLO (Second Mitochondrial Activator of Cell Death, SMAC, DFNA64) (APC)
MBS6414100-02 5x 0.1 mL

DIABLO (Second Mitochondrial Activator of Cell Death, SMAC, DFNA64) (APC)

Sign In for Pricing
View Details
Human RTN2 Pre-designed siRNA Set A
SI014157A 1 Each

Human RTN2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SMARCA2 Polyclonal Antibody APC Conjugated
orb1539839 100 µL

SMARCA2 Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
Rat Bactericidal permeability-increasing protein, BPI ELISA Kit
CK-bio-14269-01 48 Tests

Rat Bactericidal permeability-increasing protein, BPI ELISA Kit

Sign In for Pricing
View Details