Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN6 Rabbit pAb (APR23787N)

Product Specifications

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The protein encoded by this gene is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2 protein. It functions as a negative regulator of retinoic acid-inducible gene I-like receptor-mediated immune signaling via its interaction with the mitochondrial antiviral signaling-centered signalosome. This gene uses alternative polyadenylation sites, and multiple transcript variants result from alternative splicing. [provided by RefSeq, Jul 2013]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSPAN6 Rabbit pAb (APR23787N) .

Synonyms

T245; TM4SF6; TSPAN-6; TSPAN6

Gene ID

7105

UniProt

O43657

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7105

Uniprot URL

https://www.uniprot.org/uniprot/O43657

AA Sequence

NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM38 Mouse Monoclonal Antibody [Clone ID: LBI2G9]
AMM13589V 100 µL

TRIM38 Mouse Monoclonal Antibody [Clone ID: LBI2G9]

Sign In for Pricing
View Details
Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit
MBS9354217-01 48 Well

Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit

Sign In for Pricing
View Details
Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit
MBS9354217-02 96 Well

Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit

Sign In for Pricing
View Details
Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit
MBS9354217-03 5x 96 Well

Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit

Sign In for Pricing
View Details
Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit
MBS9354217-04 10x 96 Well

Porcine Ras-Related Protein Rap-1A (RAP1A) ELISA Kit

Sign In for Pricing
View Details
LCL2 Antibody
orb847657 2 mg

LCL2 Antibody

Sign In for Pricing
View Details