Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS23 Rabbit pAb (APR23775N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPS23 Rabbit pAb (APR23775N) .

Synonyms

S23; RPS23

Gene ID

6228

UniProt

P62266

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6228

Uniprot URL

https://www.uniprot.org/uniprot/P62266

AA Sequence

PFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)
250712-ML550 100 µL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)

Sign In for Pricing
View Details
C17orf82 Polyclonal Antibody, Cy5.5 Conjugated
bs-9649R-Cy5.5 100 µL

C17orf82 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
RACGAP1 (7B5) Mouse Monoclonal antibody
E28PE0876 100 µL

RACGAP1 (7B5) Mouse Monoclonal antibody

Sign In for Pricing
View Details
FAM156B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0749708 1.0 µg DNA

FAM156B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) rps3 Polyclonal Antibody
MBS7150690 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) rps3 Polyclonal Antibody

Sign In for Pricing
View Details
Cd24a Rat Monoclonal Antibody [Clone ID: 30-F1]
AM08069AC-N 100 µg

Cd24a Rat Monoclonal Antibody [Clone ID: 30-F1]

Sign In for Pricing
View Details