Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE6G Rabbit pAb (APR23763N)

Product Specifications

Background

This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PDE6G Rabbit pAb (APR23763N) .

Synonyms

PDEG; RP57; PDE6G

Gene ID

5148

UniProt

P18545

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5148

Uniprot URL

https://www.uniprot.org/uniprot/P18545

AA Sequence

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COASY Recombinant Rabbit Monoclonal Antibody [JE58-56]
HA721128 100 µL

COASY Recombinant Rabbit Monoclonal Antibody [JE58-56]

Sign In for Pricing
View Details
PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (HRP)
MBS6179331-01 0.1 mL

PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (HRP)

Sign In for Pricing
View Details
PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (HRP)
MBS6179331-02 5x 0.1 mL

PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit, AMPK, AMPKa1, MGC33776, MGC57364) (HRP)

Sign In for Pricing
View Details
Rabbit Monoclonal COMMD9 Antibody (005) [DyLight 650]
NBP2-90292C 0.1 mL

Rabbit Monoclonal COMMD9 Antibody (005) [DyLight 650]

Sign In for Pricing
View Details
Rabbit Polyclonal Latrophilin 3/LPHN3 Antibody
NLS1138 0.05 mL

Rabbit Polyclonal Latrophilin 3/LPHN3 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, RFP) (25)
GTR15276119 1 Vial

Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details