Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH2 Rabbit pAb (APR23736N)

Product Specifications

Background

This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DPH2 Rabbit pAb (APR23736N) .

Synonyms

DPH2L2; DPH2

Gene ID

1802

UniProt

Q9BQC3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1802

Uniprot URL

https://www.uniprot.org/uniprot/Q9BQC3

AA Sequence

VAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSCCPDTGKTQDEGARAGRLRARRRYLVERARDARVVGLLAGTLGVAQHREALAHLRNLTQAAGKRSYVLALGRPTPAKLANF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KB2 (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Threonine-protein Kinase 14B, STK14B) (AP) discontinued
132828-AP 100 µL

RPS6KB2 (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Threonine-protein Kinase 14B, STK14B) (AP) discontinued

Sign In for Pricing
View Details
Tchp Mouse shRNA Lentiviral Particle (Locus ID 77832)
TL515257V 500 µL Each

Tchp Mouse shRNA Lentiviral Particle (Locus ID 77832)

Sign In for Pricing
View Details
OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)
MF-0104359-01 5 µg

OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)

Sign In for Pricing
View Details
OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)
MF-0104359-02 10 µg

OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)

Sign In for Pricing
View Details
OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)
MF-0104359-03 20 µg

OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)

Sign In for Pricing
View Details
OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)
MF-0104359-04 50 µg

OmpK36 Protein, Klebsiella pneumoniae, Recombinant (His)

Sign In for Pricing
View Details