Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR4 Rabbit pAb (APR23636N)

Product Specifications

Background

The protein encoded by this gene belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCR4 Rabbit pAb (APR23636N) .

Synonyms

CCR4; CC-CKR-4; CD194; CKR4; CMKBR4; ChemR13; HGCN:14099; K5-5

Gene ID

1233

UniProt

P51679

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1233

Uniprot URL

https://www.uniprot.org/uniprot/P51679

AA Sequence

MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RanBP1 Antibody [Alexa Fluor 700]
NB100-79815AF700 0.1 mL

Rabbit Polyclonal RanBP1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Human IL11 ELISA Kit
orb390931 96 Tests

Human IL11 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CaM Kinase II alpha [p Thr286] Antibody
NB300-184-0.02mL 0.02 mL

Rabbit Polyclonal CaM Kinase II alpha [p Thr286] Antibody

Sign In for Pricing
View Details
Cyclo (-His-Pro)
sc-294122 25 mg

Cyclo (-His-Pro)

Sign In for Pricing
View Details
[pThr183/Tyr185]Jnk1/2 ELISA kit
ADI-900-106 96 Well

[pThr183/Tyr185]Jnk1/2 ELISA kit

Sign In for Pricing
View Details
Recombinant Human CD11d/ITGAD Protein, N-His
AP92198 50 µg

Recombinant Human CD11d/ITGAD Protein, N-His

Sign In for Pricing
View Details