Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A11 Rabbit pAb (APR23601N)

Product Specifications

Background

This gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family of proteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance. The encoded protein is a sodium independent sulfate transporter that is sensitive to the anion exchanger inhibitor 4,4'-diisothiocyanostilbene-2,2'-disulfonic acid. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC26A11 Rabbit pAb (APR23601N) .

Synonyms

SLC26A11

Gene ID

284129

UniProt

Q86WA9

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=284129

Uniprot URL

https://www.uniprot.org/uniprot/Q86WA9

AA Sequence

EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P62-derived UBA domain, (agarose immobilized)
BML-UW9010-0500 0.5 mL

P62-derived UBA domain, (agarose immobilized)

Sign In for Pricing
View Details
PRAMEF15 Rabbit Polyclonal Antibody
orb327086 100 µL

PRAMEF15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
TRV-0057261-01 20 µL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
TRV-0057261-02 100 µL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
TRV-0057261-03 200 µL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)
TRV-0057261-04 1 mL

Polyclonal Antibody to Fibroblast Growth Factor 10 (FGF10)

Sign In for Pricing
View Details