Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC3 Rabbit pAb (APR23584N)

Product Specifications

Background

Nucleic acid-binding protein involved in innate immune response to DNA and RNA viruses. Binds DNA and RNA in the cytoplasm and acts by promoting recognition of viral nucleic acids by virus sensors, such as DDX58/RIG-I, IFIH1/MDA5 and CGAS. Acts as a co-sensor for recognition of double-stranded DNA (dsDNA by cGAS in the cytoplasm, thereby playing a role in innate immune response to cytosolic dsDNA and DNA virus. Binds dsDNA and probably acts by promoting sensing of dsDNA by CGAS, leading to enhance CGAS oligomerization and activation. Promotes sensing of viral RNA by RIG-I-like receptors proteins DDX58/RIG-I and IFIH1/MDA5 via two mechanisms: binds double-stranded RNA (dsRNA, enhancing the binding of DDX58/RIG-I and IFIH1/MDA5 to dsRNA and promotes 'Lys-63'-linked ubiquitination and subsequent activation of DDX58/RIG-I and IFIH1/MDA5.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZCCHC3 Rabbit pAb (APR23584N) .

Synonyms

ZCCHC3; C20orf99

Gene ID

85364

UniProt

Q9NUD5

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=85364

Uniprot URL

https://www.uniprot.org/uniprot/Q9NUD5

AA Sequence

SFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD44 Antibody (740017) [FITC]
FAB6577F 0.1 mL

Mouse Monoclonal CD44 Antibody (740017) [FITC]

Ask
View Details
LAIR-1, Recombinant, Human, aa22-125 (Leukocyte-associated immunoglobulin-like receptor 1 isoform a, LAIR1, CD305) discontinued, see L1100-02
350027-01 100 µg

LAIR-1, Recombinant, Human, aa22-125 (Leukocyte-associated immunoglobulin-like receptor 1 isoform a, LAIR1, CD305) discontinued, see L1100-02

Ask
View Details
LAIR-1, Recombinant, Human, aa22-125 (Leukocyte-associated immunoglobulin-like receptor 1 isoform a, LAIR1, CD305) discontinued, see L1100-02
350027-02 500 µg

LAIR-1, Recombinant, Human, aa22-125 (Leukocyte-associated immunoglobulin-like receptor 1 isoform a, LAIR1, CD305) discontinued, see L1100-02

Ask
View Details
INPP5K (Inositol Polyphosphate 5-phosphatase K, Skeletal Muscle and Kidney-enriched Inositol Phosphatase, PPS, SKIP) (MaxLight 490)
128532-ML490 100 µL

INPP5K (Inositol Polyphosphate 5-phosphatase K, Skeletal Muscle and Kidney-enriched Inositol Phosphatase, PPS, SKIP) (MaxLight 490)

Ask
View Details
PFKP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]
TA503985AM 100 µL

PFKP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

Ask
View Details
Rabbit Polyclonal 53BP1 Antibody [Alexa Fluor 532]
NB100-904AF532 0.1 mL

Rabbit Polyclonal 53BP1 Antibody [Alexa Fluor 532]

Ask
View Details