Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSPN Rabbit pAb (APR23569N)

Product Specifications

Background

The product of this gene is an essential upstream regulator of checkpoint kinase 1 and triggers a checkpoint arrest of the cell cycle in response to replicative stress or DNA damage. The protein is also required for efficient DNA replication during a normal S phase. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLSPN Rabbit pAb (APR23569N) .

Synonyms

CLSPN; claspin

Gene ID

63967

UniProt

Q9HAW4

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 151kDa Observed MW: 275kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63967

Uniprot URL

https://www.uniprot.org/uniprot/Q9HAW4

AA Sequence

SVPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIGSTIPSYQPCNRQTGRGTSFFPTAGGFRSPSPGLF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tiopronin Sulfinic Acid
467660 250 mg

Tiopronin Sulfinic Acid

Ask
View Details
Porcine GHRH (Growth Hormone Releasing Hormone) ELISA Kit
EP22657 96 Tests

Porcine GHRH (Growth Hormone Releasing Hormone) ELISA Kit

Ask
View Details
GRAP2 (GRB2 Related Adaptor Protein 2, GRB2 Like Protein, GADS, GRB2 Related Protein With Insert Domain, GRB2L, GRBLG, GrbX, Grf40, GRID, Growth Factor Receptor Binding Protein, GRPL, SH3-SH2-SH3 Adaptor Molecule) (APC)
MBS6478925-01 0.1 mL

GRAP2 (GRB2 Related Adaptor Protein 2, GRB2 Like Protein, GADS, GRB2 Related Protein With Insert Domain, GRB2L, GRBLG, GrbX, Grf40, GRID, Growth Factor Receptor Binding Protein, GRPL, SH3-SH2-SH3 Adaptor Molecule) (APC)

Ask
View Details
GRAP2 (GRB2 Related Adaptor Protein 2, GRB2 Like Protein, GADS, GRB2 Related Protein With Insert Domain, GRB2L, GRBLG, GrbX, Grf40, GRID, Growth Factor Receptor Binding Protein, GRPL, SH3-SH2-SH3 Adaptor Molecule) (APC)
MBS6478925-02 5x 0.1 mL

GRAP2 (GRB2 Related Adaptor Protein 2, GRB2 Like Protein, GADS, GRB2 Related Protein With Insert Domain, GRB2L, GRBLG, GrbX, Grf40, GRID, Growth Factor Receptor Binding Protein, GRPL, SH3-SH2-SH3 Adaptor Molecule) (APC)

Ask
View Details
CRLF3, CT (CRLF3, CREME9, CYTOR4, P48, Cytokine receptor-like factor 3, Cytokine receptor-like molecule 9, Cytokine receptor-related protein 4, Type I cytokine receptor-like factor p48)
034235 200 µL

CRLF3, CT (CRLF3, CREME9, CYTOR4, P48, Cytokine receptor-like factor 3, Cytokine receptor-like molecule 9, Cytokine receptor-related protein 4, Type I cytokine receptor-like factor p48)

Ask
View Details
Chicken Testis-Expressed Sequence 11 Protein (TEX11) ELISA Kit
MBS9922690 Inquire

Chicken Testis-Expressed Sequence 11 Protein (TEX11) ELISA Kit

Ask
View Details