Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSTC Rabbit pAb (APR23565N)

Product Specifications

Background

Subunit of the oligosaccharyl transferase (OST complex that catalyzes the initial transfer of a defined glycan (Glc (3Man (9GlcNAc (2 in eukaryotes from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER. All subunits are required for a maximal enzyme activity. May be involved in N-glycosylation of APP (amyloid-beta precursor protein. Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OSTC Rabbit pAb (APR23565N) .

Synonyms

OSTC; DC2

Gene ID

58505

UniProt

Q9NRP0

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=58505

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRP0

AA Sequence

YDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Whrn AAV Vector (Mouse) (CMV)
50422105 1 µg

Whrn AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Trpa1 (NM_207608) Rat Untagged Clone
RN203182 10 µg

Trpa1 (NM_207608) Rat Untagged Clone

Sign In for Pricing
View Details
GIMAP6 (GTPase IMAP Family Member 6)
481793 100 µL

GIMAP6 (GTPase IMAP Family Member 6)

Sign In for Pricing
View Details
Rat Vitamin D Binding Protein (DBP) ELISA Kit
EKU08166 96 Tests

Rat Vitamin D Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
FBP1 (G-8) HRP
sc-271241 HRP 200 µg/mL

FBP1 (G-8) HRP

Sign In for Pricing
View Details
Rat Pqbp1 Pre-designed siRNA Set B
SI211010B 1 Each

Rat Pqbp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details