Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHA10 Rabbit pAb (APR23559N)

Product Specifications

Background

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PCDHA10 Rabbit pAb (APR23559N) .

Synonyms

PCDHA10; CNR8; CNRN8; CNRS8; CRNR8; PCDH-ALPHA10

Gene ID

56139

UniProt

Q9Y5I2

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56139

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5I2

AA Sequence

PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CCDC61 siRNA
abx910655-01 15 nmol

Mouse CCDC61 siRNA

Sign In for Pricing
View Details
Mouse CCDC61 siRNA
abx910655-02 30 nmol

Mouse CCDC61 siRNA

Sign In for Pricing
View Details
Rabbit Polyclonal C5orf22 Antibody [mFluor Violet 450 SE]
NBP2-98180MFV450 0.1 mL

Rabbit Polyclonal C5orf22 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Tryptic Soy Agar (TSA) Plates w/ Spect-10
30629731-5 80 Plates

Tryptic Soy Agar (TSA) Plates w/ Spect-10

Sign In for Pricing
View Details
TRNAQ26 Protein Lysate (Human) with C-Ha Tag
48296031 100 µg

TRNAQ26 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rat Kif6 Pre-designed siRNA Set B
SI207251B 1 Each

Rat Kif6 Pre-designed siRNA Set B

Sign In for Pricing
View Details