Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP4 Rabbit pAb (APR23546N)

Product Specifications

Background

Involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site. In case of infection by Herpes simplex virus (HSVI, may act as a splicing inhibitor of HSVI pre-mRNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARL6IP4 Rabbit pAb (APR23546N) .

Synonyms

ARL6IP4; SFRS20; SR-25; SRp25; SRrp37

Gene ID

51329

UniProt

Q66PJ3

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/28kDa/38kDa/42kDa/43kDa/44kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51329

Uniprot URL

https://www.uniprot.org/uniprot/Q66PJ3

AA Sequence

SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr889 Protein Vector (Mouse) (pPM-C-HA)
PV211988 500 ng

Olfr889 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Cdk5rap1 shRNA (UAS) - Lentiviral mouse Cdk5rap1 shRNA (UAS, GFP) plasmid
GTR15192670 1 Vial

Lentiviral mouse Cdk5rap1 shRNA (UAS) - Lentiviral mouse Cdk5rap1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Ccr6 ELISA Kit
EF013323 96 Tests

Mouse Ccr6 ELISA Kit

Sign In for Pricing
View Details
Rat EGLN2 shRNA Plasmid
abx989492-01 150 µg

Rat EGLN2 shRNA Plasmid

Sign In for Pricing
View Details
Rat EGLN2 shRNA Plasmid
abx989492-02 300 µg

Rat EGLN2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse IL-3 Affinity Purified Polyclonal Ab
AF-403-SP 25 µg

Mouse IL-3 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details