Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP4 Rabbit pAb (APR23546N)

Product Specifications

Background

Involved in modulating alternative pre-mRNA splicing with either 5' distal site activation or preferential use of 3' proximal site. In case of infection by Herpes simplex virus (HSVI, may act as a splicing inhibitor of HSVI pre-mRNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARL6IP4 Rabbit pAb (APR23546N) .

Synonyms

ARL6IP4; SFRS20; SR-25; SRp25; SRrp37

Gene ID

51329

UniProt

Q66PJ3

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/28kDa/38kDa/42kDa/43kDa/44kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51329

Uniprot URL

https://www.uniprot.org/uniprot/Q66PJ3

AA Sequence

SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZDHHC15 knockout cell line
ABC-KH17246 1 Vial

Human ZDHHC15 knockout cell line

Sign In for Pricing
View Details
CHRND Recombinant Protein (Human)
RP052108 100 µg

CHRND Recombinant Protein (Human)

Sign In for Pricing
View Details
Dicer, His-Tag (Human) Recombinant
79083-2 50 µg

Dicer, His-Tag (Human) Recombinant

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum argS Protein (aa 1-563) (strain 657 / Type Ba4)
VAng-Lsx7960-inquire Inquire

Recombinant Clostridium Botulinum argS Protein (aa 1-563) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
NDUFA9 Recombinant Protein Antigen
NBP2-13646PEP 0.1 mL

NDUFA9 Recombinant Protein Antigen

Sign In for Pricing
View Details
Guinea Pig Amine oxidase, copper containing 3 ELISA Kit
MBS7274151-01 48 Well

Guinea Pig Amine oxidase, copper containing 3 ELISA Kit

Sign In for Pricing
View Details