Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT6B Rabbit pAb (APR23533N)

Product Specifications

Background

The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KAT6B Rabbit pAb (APR23533N) .

Synonyms

KAT6B; GTPTS; MORF; MOZ2; MYST4; ZC2HC6B; qkf; querkopf

Gene ID

23522

UniProt

Q8WYB5

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 280kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23522

Uniprot URL

https://www.uniprot.org/uniprot/Q8WYB5

AA Sequence

DLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC14 Antibody, HRP conjugated
CSB-PA839379LB01HU-01 50 μL

TTC14 Antibody, HRP conjugated

Sign In for Pricing
View Details
TTC14 Antibody, HRP conjugated
CSB-PA839379LB01HU-02 100 µL

TTC14 Antibody, HRP conjugated

Sign In for Pricing
View Details
MYPT1 (C-6) AC
sc-514261 AC 500 µg/mL - 25% ag

MYPT1 (C-6) AC

Sign In for Pricing
View Details
TESSP1, ID (PRSS41, TESSP1, Putative serine protease 41, Testis serine protease 1)
042746 200 µL

TESSP1, ID (PRSS41, TESSP1, Putative serine protease 41, Testis serine protease 1)

Sign In for Pricing
View Details
Ighg1 (BC057688) Mouse Tagged ORF Clone
MG207348 10 µg

Ighg1 (BC057688) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NT5DC1 siRNA Oligos set (Human)
32228171 3x 5 nmol

NT5DC1 siRNA Oligos set (Human)

Sign In for Pricing
View Details