Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT6B Rabbit pAb (APR23533N)

Product Specifications

Background

The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KAT6B Rabbit pAb (APR23533N) .

Synonyms

KAT6B; GTPTS; MORF; MOZ2; MYST4; ZC2HC6B; qkf; querkopf

Gene ID

23522

UniProt

Q8WYB5

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 280kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23522

Uniprot URL

https://www.uniprot.org/uniprot/Q8WYB5

AA Sequence

DLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nori® Human CD24 ELISA Kit- 2 Plates
GR111008-2 2x 96 Well

Nori® Human CD24 ELISA Kit- 2 Plates

Ask
View Details
EIF2C2 (Protein Argonaute-2, Argonaute2, hAgo2, Eukaryotic Translation Initiation Factor 2C 2, eIF-2C 2, eIF2C 2, PAZ Piwi Domain Protein, PPD, Protein Slicer, AGO2) APC
MBS6136383-01 0.1 mL

EIF2C2 (Protein Argonaute-2, Argonaute2, hAgo2, Eukaryotic Translation Initiation Factor 2C 2, eIF-2C 2, eIF2C 2, PAZ Piwi Domain Protein, PPD, Protein Slicer, AGO2) APC

Ask
View Details
EIF2C2 (Protein Argonaute-2, Argonaute2, hAgo2, Eukaryotic Translation Initiation Factor 2C 2, eIF-2C 2, eIF2C 2, PAZ Piwi Domain Protein, PPD, Protein Slicer, AGO2) APC
MBS6136383-02 5x 0.1 mL

EIF2C2 (Protein Argonaute-2, Argonaute2, hAgo2, Eukaryotic Translation Initiation Factor 2C 2, eIF-2C 2, eIF2C 2, PAZ Piwi Domain Protein, PPD, Protein Slicer, AGO2) APC

Ask
View Details
GPR75 Knockout Hela Polyclonal Cells
ARG36086 1 Million

GPR75 Knockout Hela Polyclonal Cells

Ask
View Details
CEP97 Rabbit Polyclonal Antibody
TA349797 100 µL

CEP97 Rabbit Polyclonal Antibody

Ask
View Details
FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (AP)
MBS6297581-01 0.2 mL

FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (AP)

Ask
View Details