What is the catalog number for CAPN9 Rabbit pAb (APR23518N)?

The catalog number for CAPN9 Rabbit pAb (APR23518N) is APR23518N.

What sizes are available for CAPN9 Rabbit pAb (APR23518N)?

CAPN9 Rabbit pAb (APR23518N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does CAPN9 Rabbit pAb (APR23518N) come in?

CAPN9 Rabbit pAb (APR23518N) is available in 3 different pack sizes.

Is CAPN9 Rabbit pAb (APR23518N) in stock?

CAPN9 Rabbit pAb (APR23518N) is currently made to order / not held in immediate stock. Contact us for lead time.

CAPN9 Rabbit pAb (APR23518N)

Product Specifications

Background

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CAPN9 Rabbit pAb (APR23518N) .

Synonyms

CAPN9; GC36; nCL-4; calpain-9

Gene ID

10753

UniProt

O14815

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 76kDa/79kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10753

Uniprot URL

https://www.uniprot.org/uniprot/O14815

AA Sequence

QEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI