Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN9 Rabbit pAb (APR23518N)

Product Specifications

Background

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CAPN9 Rabbit pAb (APR23518N) .

Synonyms

CAPN9; GC36; nCL-4; calpain-9

Gene ID

10753

UniProt

O14815

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 76kDa/79kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10753

Uniprot URL

https://www.uniprot.org/uniprot/O14815

AA Sequence

QEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nme7 Antibody - N-terminal region
MBS3217102-01 0.1 mL

Nme7 Antibody - N-terminal region

Sign In for Pricing
View Details
Nme7 Antibody - N-terminal region
MBS3217102-02 5x 0.1 mL

Nme7 Antibody - N-terminal region

Sign In for Pricing
View Details
23S-hydroxyl-11,15-dioxo-ganoderic acid DM
TBW00265 5mg

23S-hydroxyl-11,15-dioxo-ganoderic acid DM

Sign In for Pricing
View Details
Human Tn-?…? ELISA Kit
EHT0531 96 Tests

Human Tn-?…? ELISA Kit

Sign In for Pricing
View Details
Cathelicidin Antibody HRP Conjugated
C05377H 100 µL

Cathelicidin Antibody HRP Conjugated

Sign In for Pricing
View Details
Phospho-Akt (Ser473) Antibody
MBS8510560-01 0.05 mg

Phospho-Akt (Ser473) Antibody

Sign In for Pricing
View Details