Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNKS Rabbit pAb (APR23486N)

Product Specifications

Background

Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation (PARsylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates PARsylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates PARsylation of TERF1, thereby contributing to the regulation of telomere length. Involved in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. May be involved in spindle pole assembly through PARsylation of NUMA1. Stimulates 26S proteasome activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNKS Rabbit pAb (APR23486N) .

Synonyms

TNKS; ARTD5; PARP-5a; PARP5A; PARPL; TIN1; TINF1; TNKS1; pART5; tankyrase

Gene ID

8658

UniProt

O95271

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/142kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8658

Uniprot URL

https://www.uniprot.org/uniprot/O95271

AA Sequence

EQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1561730 3'UTR GFP Stable Cell Line
TU268446 1.0 mL

RGD1561730 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal GITR/TNFRSF18 Antibody (T9P4G4-D7) [Alexa Fluor 350]
NBP2-50337AF350 0.1 mL

Mouse Monoclonal GITR/TNFRSF18 Antibody (T9P4G4-D7) [Alexa Fluor 350]

Sign In for Pricing
View Details
PLK4/STK18 Rabbit pAb, PE-Cy7 conjugated
orb2880429 100 µL

PLK4/STK18 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
SERPING1 Rabbit pAb (APR19038N)
APR19038N-01 50 µL

SERPING1 Rabbit pAb (APR19038N)

Sign In for Pricing
View Details
SERPING1 Rabbit pAb (APR19038N)
APR19038N-02 100 µL

SERPING1 Rabbit pAb (APR19038N)

Sign In for Pricing
View Details
SERPING1 Rabbit pAb (APR19038N)
APR19038N-03 200 µL

SERPING1 Rabbit pAb (APR19038N)

Sign In for Pricing
View Details