Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THY1 Rabbit pAb (APR23461N)

Product Specifications

Background

This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality THY1 Rabbit pAb (APR23461N) .

Synonyms

THY1; CD90; CDw90

Gene ID

7070

UniProt

P04216

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7070

Uniprot URL

https://www.uniprot.org/uniprot/P04216

AA Sequence

DQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Formiminoglutamic acid
orb1697164-01 1 mg

Formiminoglutamic acid

Sign In for Pricing
View Details
Formiminoglutamic acid
orb1697164-02 5 mg

Formiminoglutamic acid

Sign In for Pricing
View Details
Formiminoglutamic acid
orb1697164-03 10 mg

Formiminoglutamic acid

Sign In for Pricing
View Details
Formiminoglutamic acid
orb1697164-04 25 mg

Formiminoglutamic acid

Sign In for Pricing
View Details
DUSP6 polyclonal antibody
BS78426-01 50 µL

DUSP6 polyclonal antibody

Sign In for Pricing
View Details
DUSP6 polyclonal antibody
BS78426-02 100 µL

DUSP6 polyclonal antibody

Sign In for Pricing
View Details