Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC1 Rabbit pAb (APR23455N)

Product Specifications

Background

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STC1 Rabbit pAb (APR23455N) .

Synonyms

STC1; STC

Gene ID

6781

UniProt

P52823

Dilution

WB 1:1000 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/27kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6781

Uniprot URL

https://www.uniprot.org/uniprot/P52823

AA Sequence

THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O9:H4 (strain HS) RNFH Polyclonal Antibody
MBS7168651 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) RNFH Polyclonal Antibody

Sign In for Pricing
View Details
AOAH Antibody
orb419599 100 µL

AOAH Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal FASTKD1 Antibody
NBP1-32639 0.1 mL

Rabbit Polyclonal FASTKD1 Antibody

Sign In for Pricing
View Details
NCOA4 Recombinant Protein (Mouse)
RP153314 100 µg

NCOA4 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
C17orf81 (ELP5) CytoSection
TS414402P5 25 Slides

C17orf81 (ELP5) CytoSection

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) CYSZ Polyclonal Antibody
MBS7174327 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) CYSZ Polyclonal Antibody

Sign In for Pricing
View Details