Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL19 Rabbit pAb (APR23452N)

Product Specifications

Background

This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCL19 Rabbit pAb (APR23452N) .

Synonyms

CCL19; CKb11; ELC; MIP-3b; MIP3B; SCYA19

Gene ID

6363

UniProt

Q99731

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6363

Uniprot URL

https://www.uniprot.org/uniprot/Q99731

AA Sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit
MBS9338907-01 48 Well

Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit

Ask
View Details
Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit
MBS9338907-02 96 Well

Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit

Ask
View Details
Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit
MBS9338907-03 5x 96 Well

Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit

Ask
View Details
Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit
MBS9338907-04 10x 96 Well

Human Endothelial zinc finger protein induced by tumor necrosis factor alpha, ZNF71 ELISA Kit

Ask
View Details
Mlycd Rat Pre-designed siRNA Set A
HY-RS28168 1 Set

Mlycd Rat Pre-designed siRNA Set A

Ask
View Details
Pgpep1 (NM_023217) Mouse Tagged ORF Clone
MG202232 10 µg

Pgpep1 (NM_023217) Mouse Tagged ORF Clone

Ask
View Details