Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF Rabbit pAb (APR23445N)

Product Specifications

Background

Heparin-binding EGF-like growth factor (HB-EGF) is a 12-16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGF-like domain, and a heparin-binding motif. Mature HB-EGF is a soluble peptide thatarises from proteolytic processing of the transmembrane form. Human HB -EGF shows 76% and 73% aasequence identity with rat and mouse HB-EGF, respectively. It is required for normal cardiac valve formationand normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB-EGF classified as agroup 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activityassociated with ErbB4 binding appears to be limited to non -mitogenic actions, while EGFR binding inducesboth mitogenic and non-mitogenic activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HB-EGF Rabbit pAb (APR23445N) .

Synonyms

HBEGF; DTR; DTS; DTSF; HEGFL

Gene ID

1839

UniProt

Q99075

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space

Applications

WB (Homo sapiens) IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1839

Uniprot URL

https://www.uniprot.org/uniprot/Q99075

AA Sequence

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Programmed Cell Death 1 Ligand 1 (CD274) Antibody
abx403026-01 100 µL

Programmed Cell Death 1 Ligand 1 (CD274) Antibody

Sign In for Pricing
View Details
Programmed Cell Death 1 Ligand 1 (CD274) Antibody
abx403026-02 200 µL

Programmed Cell Death 1 Ligand 1 (CD274) Antibody

Sign In for Pricing
View Details
Programmed Cell Death 1 Ligand 1 (CD274) Antibody
abx403026-03 1 mL

Programmed Cell Death 1 Ligand 1 (CD274) Antibody

Sign In for Pricing
View Details
Human BCAP31 Pre-designed siRNA Set B
SI001466B 1 Each

Human BCAP31 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TRIM25 Antibody
OACA10067-50UG 50 µg

TRIM25 Antibody

Sign In for Pricing
View Details
Chicken Paired box protein Pax-7 (PAX7) ELISA Kit
EIA06875Ch 1 Kit

Chicken Paired box protein Pax-7 (PAX7) ELISA Kit

Sign In for Pricing
View Details