Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAFAH2 Rabbit pAb (APR23442N)

Product Specifications

Background

This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine) . However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PAFAH2 Rabbit pAb (APR23442N) .

Synonyms

PAFAH2; HSD-PLA2

Gene ID

5051

UniProt

Q99487

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5051

Uniprot URL

https://www.uniprot.org/uniprot/Q99487

AA Sequence

AWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk2 Monoclonal Antibody, PE-Cy5.5 Conjugated
bsm-52027R-PE-Cy5.5 100 µL

Cdk2 Monoclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Gm10228 shRNA (UAS) - Lentiviral mouse Gm10228 shRNA (UAS, iRFP) (100)
GTR15194847 1 Vial

Lentiviral mouse Gm10228 shRNA (UAS) - Lentiviral mouse Gm10228 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TAAR6 Protein Vector (Rat) (pPM-C-HA)
46027026 500 ng

TAAR6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Salmonella paratyphi O Serotype Probe-based qPCR Kit
MK1F670-01 48 Test

Salmonella paratyphi O Serotype Probe-based qPCR Kit

Sign In for Pricing
View Details
Salmonella paratyphi O Serotype Probe-based qPCR Kit
MK1F670-02 50 Tests

Salmonella paratyphi O Serotype Probe-based qPCR Kit

Sign In for Pricing
View Details
Profilin-4 CRISPR/Cas9 KO Plasmid (m)
sc-436397 20 µg

Profilin-4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details