Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK7 Rabbit pAb (APR23441N)

Product Specifications

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK) . It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK7 Rabbit pAb (APR23441N) .

Synonyms

CDK7; CAK; CAK1; CDKN7; HCAK; MO15; STK1; p39MO15

Gene ID

1022

UniProt

P50613

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1022

Uniprot URL

https://www.uniprot.org/uniprot/P50613

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FibromoduLin (FMOD) (NM_002023) Human Over-expression Lysate
LY419579 100 µg

FibromoduLin (FMOD) (NM_002023) Human Over-expression Lysate

Sign In for Pricing
View Details
CEP104 Antibody
OC-618-01 50 μL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
OC-618-02 100 µL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
OC-618-03 1 mL

CEP104 Antibody

Sign In for Pricing
View Details
IL17D Human
OM296470-01 25 µg

IL17D Human

Sign In for Pricing
View Details
IL17D Human
OM296470-02 5 µg

IL17D Human

Sign In for Pricing
View Details