CDK7 Rabbit pAb (APR23441N)
Product Specifications
Background
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK) . It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK7 Rabbit pAb (APR23441N) .
Synonyms
CDK7; CAK; CAK1; CDKN7; HCAK; MO15; STK1; p39MO15
Gene ID
1022
UniProt
P50613
Cellular Locus
Cytoplasm, Nucleus, perinuclear region
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 39kDa Observed MW: 43kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1022
Uniprot URL
https://www.uniprot.org/uniprot/P50613
AA Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-F308950-100MG 100 mg
Feruloylputrescine Trifluoroacetic Acid Salt
Sign In for Pricing
View Details MBS162211-01 48 Well
Human Protein Tyrosine Phosphatase Receptor Type B (PTPRB) ELISA Kit
Sign In for Pricing
View Details MBS162211-02 96 Well
Human Protein Tyrosine Phosphatase Receptor Type B (PTPRB) ELISA Kit
Sign In for Pricing
View Details MBS162211-03 5x 96 Well
Human Protein Tyrosine Phosphatase Receptor Type B (PTPRB) ELISA Kit
Sign In for Pricing
View Details MBS162211-04 10x 96 Well
Human Protein Tyrosine Phosphatase Receptor Type B (PTPRB) ELISA Kit
Sign In for Pricing
View Details 039947-ML650 100 µL
PHF20, NT (PHF20, C20orf104, GLEA2, HCA58, NZF, TZP, PHD finger protein 20, Glioma-expressed antigen 2, Hepatocellular carcinoma-associated antigen 58, Novel zinc finger protein, Transcription factor TZP) (MaxLight 650) discontinued
Sign In for Pricing
View Details