Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS1 Rabbit pAb (APR23435N)

Product Specifications

Background

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFS1 Rabbit pAb (APR23435N) .

Synonyms

NDUFS1; CI-75Kd; CI-75k; PRO1304

Gene ID

4719

UniProt

P28331

Cellular Locus

Mitochondrion inner membrane

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/73kDa/75kDa/79kDa/80kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4719

Uniprot URL

https://www.uniprot.org/uniprot/P28331

AA Sequence

VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AMDHD2 CRISPR/Cas9 KO Plasmid (m)
sc-434174 20 µg

AMDHD2 CRISPR/Cas9 KO Plasmid (m)

Ask
View Details
BCAS1 (Breast Carcinoma-amplified Sequence 1, Amplified and Overexpressed in Breast Cancer, Novel Amplified in Breast Cancer 1, AIBC1, NABC1) (Biotin)
MBS6140801-01 0.1 mL

BCAS1 (Breast Carcinoma-amplified Sequence 1, Amplified and Overexpressed in Breast Cancer, Novel Amplified in Breast Cancer 1, AIBC1, NABC1) (Biotin)

Ask
View Details
BCAS1 (Breast Carcinoma-amplified Sequence 1, Amplified and Overexpressed in Breast Cancer, Novel Amplified in Breast Cancer 1, AIBC1, NABC1) (Biotin)
MBS6140801-02 5x 0.1 mL

BCAS1 (Breast Carcinoma-amplified Sequence 1, Amplified and Overexpressed in Breast Cancer, Novel Amplified in Breast Cancer 1, AIBC1, NABC1) (Biotin)

Ask
View Details
ELOVL Fatty Acid Elongase 5 (ELOVL5) Antibody
abx324600-01 50 µg

ELOVL Fatty Acid Elongase 5 (ELOVL5) Antibody

Ask
View Details
ELOVL Fatty Acid Elongase 5 (ELOVL5) Antibody
abx324600-02 100 µg

ELOVL Fatty Acid Elongase 5 (ELOVL5) Antibody

Ask
View Details
Recombinant Paracentrotus lividus NADH-ubiquinone oxidoreductase chain 3 (ND3), partial
MBS7056176 Inquire

Recombinant Paracentrotus lividus NADH-ubiquinone oxidoreductase chain 3 (ND3), partial

Ask
View Details