Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFI1 Rabbit pAb (APR23400N)

Product Specifications

Background

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GFI1 Rabbit pAb (APR23400N) .

Synonyms

GFI1; GFI-1; GFI1A; SCN2; ZNF163

Gene ID

2672

UniProt

Q99684

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2672

Uniprot URL

https://www.uniprot.org/uniprot/Q99684

AA Sequence

MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARSD Antibody
A24212-100UG 100 µg

ARSD Antibody

Ask
View Details
BHLHA15 Antibody
MBS9417411-01 0.1 mL

BHLHA15 Antibody

Ask
View Details
BHLHA15 Antibody
MBS9417411-02 5x 0.1 mL

BHLHA15 Antibody

Ask
View Details
Human DDX18 qPCR Primer Pair
QH27349S 200 Tests

Human DDX18 qPCR Primer Pair

Ask
View Details
PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) (MaxLight 650)
MBS6223996-01 0.1 mL

PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) (MaxLight 650)

Ask
View Details
PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) (MaxLight 650)
MBS6223996-02 5x 0.1 mL

PPP3R2 (CBLP, PPP3RL, Calcineurin Subunit B Type 2, Calcineurin B-like Protein, Calcineurin BII, PPP3R1-like, Protein Phosphatase 2B Regulatory Subunit 2, Protein Phosphatase 3 Regulatory Subunit B beta Isoform) (MaxLight 650)

Ask
View Details