Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBP2 Rabbit pAb (APR23383N)

Product Specifications

Background

This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CTBP2 Rabbit pAb (APR23383N) .

Synonyms

CTBP2

Gene ID

1488

UniProt

P56545

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/56kDa/106kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1488

Uniprot URL

https://www.uniprot.org/uniprot/P56545

AA Sequence

SEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPT4 Polyclonal Antibody
MBS8566608-01 0.1 mL

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT4 Polyclonal Antibody
MBS8566608-02 0.1 mL (AF405L)

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT4 Polyclonal Antibody
MBS8566608-03 0.1 mL (AF405S)

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT4 Polyclonal Antibody
MBS8566608-04 0.1 mL (AF610)

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT4 Polyclonal Antibody
MBS8566608-05 0.1 mL (AF635)

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT4 Polyclonal Antibody
MBS8566608-06 0.1 mL (APC)

ANGPT4 Polyclonal Antibody

Sign In for Pricing
View Details