Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPB Rabbit pAb (APR23378N)

Product Specifications

Background

This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric alpha satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CENPB Rabbit pAb (APR23378N) .

Synonyms

CENPB

Gene ID

1059

UniProt

P07199

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1059

Uniprot URL

https://www.uniprot.org/uniprot/P07199

AA Sequence

TLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound STOCK1N-49530
MBS5792645 Inquire

Compound STOCK1N-49530

Sign In for Pricing
View Details
Recombinant Borrelia Duttonii rplT Protein (aa 1-115)
VAng-Lsx1967-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Duttonii rplT Protein (aa 1-115)

Sign In for Pricing
View Details
TAS1R3 Protein Lysate
OCOA05868-20UG 20 µg

TAS1R3 Protein Lysate

Sign In for Pricing
View Details
SARS coronavirus SZ1 Spike Trimer Protein, His Tag
SPN-S52Hz-100ug 100 µg

SARS coronavirus SZ1 Spike Trimer Protein, His Tag

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)
MBS6218387-01 0.1 mL

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)
MBS6218387-02 5x 0.1 mL

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)

Sign In for Pricing
View Details