Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPB Rabbit pAb (APR23378N)

Product Specifications

Background

This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric alpha satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CENPB Rabbit pAb (APR23378N) .

Synonyms

CENPB

Gene ID

1059

UniProt

P07199

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1059

Uniprot URL

https://www.uniprot.org/uniprot/P07199

AA Sequence

TLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor Rabbit Polyclonal Antibody
APRab00435-01 20 µL

Glucocorticoid Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucocorticoid Receptor Rabbit Polyclonal Antibody
APRab00435-02 50 µL

Glucocorticoid Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucocorticoid Receptor Rabbit Polyclonal Antibody
APRab00435-03 100 µL

Glucocorticoid Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucocorticoid Receptor Rabbit Polyclonal Antibody
APRab00435-04 200 µL

Glucocorticoid Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MFAP4 Rabbit pAb
E47R18824 100 µL

MFAP4 Rabbit pAb

Sign In for Pricing
View Details
9230110F15Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10885094 4x 500 ng

9230110F15Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details