Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRF Rabbit pAb (APR23306N)

Product Specifications

Background

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs) . Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SRF Rabbit pAb (APR23306N) .

Synonyms

SRF; MCM1

Gene ID

6722

UniProt

P11831

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa Observed MW: 68kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6722

Uniprot URL

https://www.uniprot.org/uniprot/P11831

AA Sequence

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANC-1 Cells
T1911 1x106 cells / 1.0 mL

PANC-1 Cells

Sign In for Pricing
View Details
Monkey Anti Intrinsic Factor Antibody ELISA kit
GTR10419204 96 Well

Monkey Anti Intrinsic Factor Antibody ELISA kit

Sign In for Pricing
View Details
Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit
MBS2501825-01 24 Tests

Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit

Sign In for Pricing
View Details
Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit
MBS2501825-02 48 Tests

Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit

Sign In for Pricing
View Details
Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit
MBS2501825-03 96 Tests

Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit

Sign In for Pricing
View Details
Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit
MBS2501825-04 5x 96 Tests

Rat CYTIP (Cytohesin Interacting Protein) ELISA Kit

Sign In for Pricing
View Details