Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCN2 Rabbit pAb (APR23284N)

Product Specifications

Background

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FCN2 Rabbit pAb (APR23283N0) .

Synonyms

FCN2; EBP-37; FCNL; P35; ficolin-2

Gene ID

2220

UniProt

Q15485

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2220

Uniprot URL

https://www.uniprot.org/uniprot/Q15485

AA Sequence

SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Complexin-2 Antibody (021) [Janelia Fluor 549]
NBP2-90019JF549 0.1 mL

Rabbit Monoclonal Complexin-2 Antibody (021) [Janelia Fluor 549]

Sign In for Pricing
View Details
Cancer Antigen 125 (CA 125) discontinued
470425 1 mg

Cancer Antigen 125 (CA 125) discontinued

Sign In for Pricing
View Details
RGD1563375 3'UTR GFP Stable Cell Line
TU268756 1.0 mL

RGD1563375 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Solute Carrier family 39 (member 6 (SLC39A6) Human ELISA Kit
H2203 96 Tests

Solute Carrier family 39 (member 6 (SLC39A6) Human ELISA Kit

Sign In for Pricing
View Details
Anti-Caldesmon antibody
STJ180318 0.1 ml

Anti-Caldesmon antibody

Sign In for Pricing
View Details
RAI4 AAV siRNA Pooled Vector
66636161 1.0 µg

RAI4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details