Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCN2 Rabbit pAb (APR23284N)

Product Specifications

Background

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FCN2 Rabbit pAb (APR23283N0) .

Synonyms

FCN2; EBP-37; FCNL; P35; ficolin-2

Gene ID

2220

UniProt

Q15485

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2220

Uniprot URL

https://www.uniprot.org/uniprot/Q15485

AA Sequence

SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suv420h1 (BC075709) Mouse Tagged ORF Clone
MG210794 10 µg

Suv420h1 (BC075709) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human ITIH6 activation kit by CRISPRa
GA117644 1 Kit

Human ITIH6 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal mGluR1 Antibody [Alexa Fluor 647]
NB110-39033AF647 0.1 mL

Rabbit Polyclonal mGluR1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Lentiviral mouse Traip shRNA (UAS) - Lentiviral mouse Traip shRNA (UAS, RFP) plasmid
GTR15268417 1 Vial

Lentiviral mouse Traip shRNA (UAS) - Lentiviral mouse Traip shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-Human FLT1 Monoclonal Antibody (1A117)
HB265155-01 50 µg

Anti-Human FLT1 Monoclonal Antibody (1A117)

Sign In for Pricing
View Details
Anti-Human FLT1 Monoclonal Antibody (1A117)
HB265155-02 100 µg

Anti-Human FLT1 Monoclonal Antibody (1A117)

Sign In for Pricing
View Details