Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN / Frataxin Rabbit pAb (APR23281N)

Product Specifications

Background

This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FXN / Frataxin Rabbit pAb (APR23281N) .

Synonyms

FXN; CyaY; FA; FARR; FRDA; X25; frataxin

Gene ID

2395

UniProt

Q16595

Cellular Locus

Cytoplasm, Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/21kDa/23kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2395

Uniprot URL

https://www.uniprot.org/uniprot/Q16595

AA Sequence

LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-APP-T668 Rabbit pAb
AP0200 100 µL

Phospho-APP-T668 Rabbit pAb

Sign In for Pricing
View Details
HOMER2 (NM_199330) Human Recombinant Protein
TP323154M 100 µg

HOMER2 (NM_199330) Human Recombinant Protein

Sign In for Pricing
View Details
NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) APC
MBS6387789-01 0.1 mL

NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) APC

Sign In for Pricing
View Details
NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) APC
MBS6387789-02 5x 0.1 mL

NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) APC

Sign In for Pricing
View Details
WDR76 AAV Vector (Human) (CMV)
50368102 1 µg

WDR76 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
FUNDC2P4 Protein Vector (Human) (pPM-C-HA)
PV079715 500 ng

FUNDC2P4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details