Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN / Frataxin Rabbit pAb (APR23281N)

Product Specifications

Background

This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FXN / Frataxin Rabbit pAb (APR23281N) .

Synonyms

FXN; CyaY; FA; FARR; FRDA; X25; frataxin

Gene ID

2395

UniProt

Q16595

Cellular Locus

Cytoplasm, Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/21kDa/23kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2395

Uniprot URL

https://www.uniprot.org/uniprot/Q16595

AA Sequence

LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pip5k1b 3'UTR Luciferase Stable Cell Line
TU116404 1.0 mL

Pip5k1b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C9orf126-set siRNA/shRNA/RNAi Lentivector (Human)
53885091 4x 500 ng

C9orf126-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Quick Step Human Netrin-4, Ntn4 ELISA Kit
QS1250Hu-01 48 Tests

Quick Step Human Netrin-4, Ntn4 ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Netrin-4, Ntn4 ELISA Kit
QS1250Hu-02 96 Tests

Quick Step Human Netrin-4, Ntn4 ELISA Kit

Sign In for Pricing
View Details
CCDC146 (NM_020879) Human Over-expression Lysate
LS057639-20ug 20 µg

CCDC146 (NM_020879) Human Over-expression Lysate

Sign In for Pricing
View Details
Prhoxnb 3'UTR Luciferase Stable Cell Line
TU116927 1.0 mL

Prhoxnb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details