Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN / Frataxin Rabbit pAb (APR23281N)

Product Specifications

Background

This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FXN / Frataxin Rabbit pAb (APR23281N) .

Synonyms

FXN; CyaY; FA; FARR; FRDA; X25; frataxin

Gene ID

2395

UniProt

Q16595

Cellular Locus

Cytoplasm, Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/21kDa/23kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2395

Uniprot URL

https://www.uniprot.org/uniprot/Q16595

AA Sequence

LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKA C (Thr197) Rabbit Monoclonal Antibody [KD Validation]
E51K2615 40 µL

Phospho-PKA C (Thr197) Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS9625988-01 1 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS9625988-02 5x 1 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Lentiviral mouse Dhodh shRNA (UAS) - Lentiviral mouse Dhodh shRNA (UAS, GFP) (100)
GTR15132933 1 Vial

Lentiviral mouse Dhodh shRNA (UAS) - Lentiviral mouse Dhodh shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Rat HB-EGF Protein
NBP2-35210-1mg 1 mg

Recombinant Rat HB-EGF Protein

Sign In for Pricing
View Details
RN5S94 Protein Vector (Human) (pPM-C-HA)
PV117988 500 ng

RN5S94 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details