Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN / Frataxin Rabbit pAb (APR23281N)

Product Specifications

Background

This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FXN / Frataxin Rabbit pAb (APR23281N) .

Synonyms

FXN; CyaY; FA; FARR; FRDA; X25; frataxin

Gene ID

2395

UniProt

Q16595

Cellular Locus

Cytoplasm, Mitochondrion

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/21kDa/23kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2395

Uniprot URL

https://www.uniprot.org/uniprot/Q16595

AA Sequence

LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFP-Human Lung [SCLC] Adenocarcinoma Cells (H69)
ALHC057-RFP 1ml frozen Vial

RFP-Human Lung [SCLC] Adenocarcinoma Cells (H69)

Sign In for Pricing
View Details
Paxillin, phosphorylated (Ser17) (MaxLight 405) discontinued
P3113-87C-ML405 100 µL

Paxillin, phosphorylated (Ser17) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mtap6 Protein Vector (Mouse) (pPM-C-His)
PV202613 500 ng

Mtap6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal EXOSC3 Antibody [Alexa Fluor 405]
NBP2-22261AF405 0.1 mL

Rabbit Polyclonal EXOSC3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
TRNAV22 Adenovirus (Human)
48441051 1.0 mL

TRNAV22 Adenovirus (Human)

Sign In for Pricing
View Details
Mouse Granzyme G MAb (Clone 207639)
MAB1346-SP 25 µg

Mouse Granzyme G MAb (Clone 207639)

Sign In for Pricing
View Details