Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL26 Rabbit pAb (APR23275N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPL26 Rabbit pAb (APR23275N) .

Synonyms

RPL26; DBA11; L26

Gene ID

6154

UniProt

P61254

Applications

WB (Mus musculus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6154

Uniprot URL

https://www.uniprot.org/uniprot/P61254

AA Sequence

NAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SNORD57 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44899151 3x 1.0 µg DNA

SNORD57 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
K1712, CT (CEP44, KIAA1712, Centrosomal protein of 44kD, HBV PreS1-transactivated protein 3) (FITC) discontinued
037247-FITC 200 µL

K1712, CT (CEP44, KIAA1712, Centrosomal protein of 44kD, HBV PreS1-transactivated protein 3) (FITC) discontinued

Ask
View Details
Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)
MBS1339859-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)

Ask
View Details
Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)
MBS1339859-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)

Ask
View Details
Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)
MBS1339859-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)

Ask
View Details
Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)
MBS1339859-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Putative zinc finger CCCH domain-containing protein 48 (Os07g0139000, LOC_Os07g04650)

Ask
View Details