Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROS1 Rabbit pAb (APR23265N)

Product Specifications

Background

This proto-oncogene, highly-expressed in a variety of tumor cell lines, belongs to the sevenless subfamily of tyrosine kinase insulin receptor genes. The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function as a growth or differentiation factor receptor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ROS1 Rabbit pAb (APR23255N9) .

Synonyms

ROS1; MCF3; ROS; c-ros-1

Gene ID

6098

UniProt

P08922

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 263kDa Observed MW: 263kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6098

Uniprot URL

https://www.uniprot.org/uniprot/P08922

AA Sequence

IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0599808 1.0 µg DNA

DHRS13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-TACSTD2/TROP2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134639 100 µL

Anti-TACSTD2/TROP2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
DDCT Rabbit Polyclonal Antibody (BF555)
orb2399376 100 µL

DDCT Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)
MBS1069973-01 0.02 mg (E-Coli)

Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)

Sign In for Pricing
View Details
Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)
MBS1069973-02 0.1 mg (E-Coli)

Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)

Sign In for Pricing
View Details
Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)
MBS1069973-03 0.02 mg (Yeast)

Recombinant African swine fever virus Uncharacterized protein D129L (Ken-115)

Sign In for Pricing
View Details