Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP21 Rabbit pAb (APR23259N)

Product Specifications

Background

This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP21 Rabbit pAb (APR23255N3) .

Synonyms

USP21; USP16; USP23

Gene ID

27005

UniProt

Q9UK80

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/61kDa/62kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27005

Uniprot URL

https://www.uniprot.org/uniprot/Q9UK80

AA Sequence

LSLPIPKKGFAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (1-ethyl-1H-pyrazol-5-yl) ethanone
sc-281701 100 mg

1- (1-ethyl-1H-pyrazol-5-yl) ethanone

Sign In for Pricing
View Details
Phospholipase A2 Antibody
abx344117-01 20 µL

Phospholipase A2 Antibody

Sign In for Pricing
View Details
Phospholipase A2 Antibody
abx344117-02 50 µL

Phospholipase A2 Antibody

Sign In for Pricing
View Details
Phospholipase A2 Antibody
abx344117-03 100 µL

Phospholipase A2 Antibody

Sign In for Pricing
View Details
Phospholipase A2 Antibody
abx344117-04 200 µL

Phospholipase A2 Antibody

Sign In for Pricing
View Details
Phospholipase A2 Antibody
abx344117-05 1 mL

Phospholipase A2 Antibody

Sign In for Pricing
View Details