Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD147/BSG Rabbit pAb (APR23258N)

Product Specifications

Background

The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD147/BSG Rabbit pAb (APR23255N2) .

Synonyms

BSG; 5F7; CD147; EMMPRIN; OK; TCSF; basigin

Gene ID

682

UniProt

P35613

Cellular Locus

Cell membrane, Melanosome, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/22kDa/29kDa/42kDa Observed MW: 38-65KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=682

Uniprot URL

https://www.uniprot.org/uniprot/P35613

AA Sequence

DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL
BNC682045-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®440 Maleimide
#92124 1x 1 µmol

CF®440 Maleimide

Sign In for Pricing
View Details
Human FGF-19 Recombinant Rabbit monoclonal Antibody
HA725101 100 µL

Human FGF-19 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PSMA1 Antibody
RC-15132-01 50 μL

Recombinant PSMA1 Antibody

Sign In for Pricing
View Details
Recombinant PSMA1 Antibody
RC-15132-02 100 µL

Recombinant PSMA1 Antibody

Sign In for Pricing
View Details
Recombinant PSMA1 Antibody
RC-15132-03 1 mL

Recombinant PSMA1 Antibody

Sign In for Pricing
View Details