Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CHCHD2 Rabbit pAb (APR23244N)

Product Specifications

Background

The protein encoded by this gene belongs to a class of eukaryotic CX (9) C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Synonyms

CHCHD2; C7orf17; MNRR1; NS2TP; PARK22

Gene ID

51142

UniProt

Q9Y6H1

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CHCHD2 Rabbit pAb (APR23244N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51142

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y6H1

AA Sequence

TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GNGT1-set siRNA/shRNA/RNAi Lentivector (Human)
22333091 4 x 500 ng

GNGT1-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
Quick Step Horse Phosphorylated adenosine monophosphate activated protein kinase (AMPK) ELISA Kit
QS0045Ho-01 48 Tests

Quick Step Horse Phosphorylated adenosine monophosphate activated protein kinase (AMPK) ELISA Kit

Ask
View Details
Quick Step Horse Phosphorylated adenosine monophosphate activated protein kinase (AMPK) ELISA Kit
QS0045Ho-02 96 Tests

Quick Step Horse Phosphorylated adenosine monophosphate activated protein kinase (AMPK) ELISA Kit

Ask
View Details
NF-1X CRISPR Activation Plasmid (h)
sc-402455-ACT 20 µg

NF-1X CRISPR Activation Plasmid (h)

Ask
View Details
ARVCF Oxidase antibody
20R-2590 100 uL

ARVCF Oxidase antibody

Ask
View Details