Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM10 Rabbit pAb (APR23187N)

Product Specifications

Background

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP of histone pre-mRNA in a U7 snRNP dependent manner.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LSM10 Rabbit pAb (APR23187N) .

Synonyms

LSM10; MST074; MSTP074

Gene ID

84967

UniProt

Q969L4

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84967

Uniprot URL

https://www.uniprot.org/uniprot/Q969L4

AA Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig C5b-9 Terminal Complement Complex ELISA Kit
CTK-371 96 Tests

Pig C5b-9 Terminal Complement Complex ELISA Kit

Sign In for Pricing
View Details
Standard Silica gel, 40-63μm,60Å, 12g
12011102 24 PCS

Standard Silica gel, 40-63μm,60Å, 12g

Sign In for Pricing
View Details
FBL18 shRNA (m) Lentiviral Particles
sc-145092-V 200 µL

FBL18 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Protectin (CD59) BioAssayTM ELISA Kit (Human)
027694-01 48 Tests

Protectin (CD59) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Protectin (CD59) BioAssayTM ELISA Kit (Human)
027694-02 96 Tests

Protectin (CD59) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Recombinant Dog Beta-1 adrenergic receptor (ADRB1)
MBS7007329-01 0.02 mg

Recombinant Dog Beta-1 adrenergic receptor (ADRB1)

Sign In for Pricing
View Details