Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A31 Rabbit pAb (APR23177N)

Product Specifications

Background

The protein encoded by this gene is a member of the ADP/ATP carrier family of proteins that exchange cytosolic ADP for matrix ATP in the mitochondria. Cells over-expressing this gene have been shown to display an anti-apoptotic phenotype. This protein is also thought to play a role in spermatogenesis, where it is believed to associate with a part of the flagellar cytoskeleton and with glycolytic enzymes. Male mice with mutations in the mouse ortholog of this gene are sterile and spermatocytes display an early meiotic arrest phenotype. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC25A31 Rabbit pAb (APR23177N) .

Synonyms

SLC25A31; AAC4; ANT 4; ANT4; SFEC35kDa

Gene ID

83447

UniProt

Q9H0C2

Cellular Locus

Cell projection, Mitochondrion inner membrane, Multi-pass membrane protein, cilium, flagellum

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83447

Uniprot URL

https://www.uniprot.org/uniprot/Q9H0C2

AA Sequence

NFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC109340 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV695613 1.0 µg DNA

MGC109340 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Donkey Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit
MBS9912559 Inquire

Donkey Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit

Sign In for Pricing
View Details
VPS16 (Vacuolar Protein Sorting-associated Protein 16 Homolog, hVPS16) (MaxLight 750) discontinued
135271-ML750 100 µL

VPS16 (Vacuolar Protein Sorting-associated Protein 16 Homolog, hVPS16) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 750)
MBS6378381-01 0.1 mL

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 750)

Sign In for Pricing
View Details
FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 750)
MBS6378381-02 5x 0.1 mL

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 750)

Sign In for Pricing
View Details
MGC4618 Antibody - N-terminal region : Biotin (ARP34360_P050-Biotin)
ARP34360_P050-Biotin 100 µL

MGC4618 Antibody - N-terminal region : Biotin (ARP34360_P050-Biotin)

Sign In for Pricing
View Details