Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL15 Rabbit pAb (APR23174N)

Product Specifications

Background

This gene encodes a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. The encoded protein may be involved in protein ubiquitination and cytoskeletal organization.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLHL15 Rabbit pAb (APR23174N) .

Synonyms

KLHL15; HEL-S-305

Gene ID

80311

UniProt

Q96M94

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80311

Uniprot URL

https://www.uniprot.org/uniprot/Q96M94

AA Sequence

MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD177 Antibody
OACA05774-100UG 100 µg

CD177 Antibody

Sign In for Pricing
View Details
TMEM163 Recombinant Protein (Rat)
RP233576 100 µg

TMEM163 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Donkey DEP Domain-Containing Protein 5 (DEPDC5) ELISA Kit
MBS9916316 Inquire

Donkey DEP Domain-Containing Protein 5 (DEPDC5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Arginine repressor (argR)
MBS1124413-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Arginine repressor (argR)
MBS1124413-02 0.1 mg (E-Coli)

Recombinant Erwinia tasmaniensis Arginine repressor (argR)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Arginine repressor (argR)
MBS1124413-03 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis Arginine repressor (argR)

Sign In for Pricing
View Details