Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Rabbit pAb (APR23166N)

Product Specifications

Background

This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38) . Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ELOVL5 Rabbit pAb (APR23166N) .

Synonyms

ELOVL5; HELO1; SCA38; dJ483K16.1

Gene ID

60481

UniProt

Q9NYP7

Cellular Locus

Cell projection, Endoplasmic reticulum membrane, Multi-pass membrane protein, dendrite

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/35kDa/38kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=60481

Uniprot URL

https://www.uniprot.org/uniprot/Q9NYP7

AA Sequence

GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hoxd8 shRNA (UAS) - Lentiviral mouse Hoxd8 shRNA (UAS, iRFP) plasmid
GTR15247456 1 Vial

Lentiviral mouse Hoxd8 shRNA (UAS) - Lentiviral mouse Hoxd8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MAPK9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
28076065 1.0 µg DNA

MAPK9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-NMDAR1 (Ser890) Rabbit Polyclonal Antibody (BF405)
orb1598240 100 µL

Phospho-NMDAR1 (Ser890) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
E2F1 (H357) Antibody Blocking peptide
orb1446301 500 µg

E2F1 (H357) Antibody Blocking peptide

Sign In for Pricing
View Details
AdmiRa-rno-miR-93-5p-Off Virus
mr5670 1.0 mL

AdmiRa-rno-miR-93-5p-Off Virus

Sign In for Pricing
View Details
CYP4F33P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV722241 1.0 µg DNA

CYP4F33P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details