Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL5 Rabbit pAb (APR23166N)

Product Specifications

Background

This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38) . Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ELOVL5 Rabbit pAb (APR23166N) .

Synonyms

ELOVL5; HELO1; SCA38; dJ483K16.1

Gene ID

60481

UniProt

Q9NYP7

Cellular Locus

Cell projection, Endoplasmic reticulum membrane, Multi-pass membrane protein, dendrite

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/35kDa/38kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=60481

Uniprot URL

https://www.uniprot.org/uniprot/Q9NYP7

AA Sequence

GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXR2 Protein Lysate (Human) with C-Ha Tag
21091031 100 µg

FXR2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (SAA2098)
RVV25101 100 μg

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (SAA2098)

Sign In for Pricing
View Details
TCPTP (PTPN2) (NM_080423) Human Recombinant Protein
TP305090M 100 µg

TCPTP (PTPN2) (NM_080423) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human PDCD1/PD-1/CD279 (C-mFc)
C754-50ug 50 µg

Recombinant Human PDCD1/PD-1/CD279 (C-mFc)

Sign In for Pricing
View Details
Glut 4 (R271) pAb
E18-5386-2 100 µg -100 µL

Glut 4 (R271) pAb

Sign In for Pricing
View Details
Recombinant Human UNKL Protein
E30P8300 20 µg

Recombinant Human UNKL Protein

Sign In for Pricing
View Details