Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF471 Rabbit pAb (APR23159N)

Product Specifications

Background

May be involved in transcriptional regulation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF471 Rabbit pAb (APR23159N) .

Synonyms

ZNF471; ERP1; Z1971

Gene ID

57573

UniProt

Q9BX82

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/73kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57573

Uniprot URL

https://www.uniprot.org/uniprot/Q9BX82

AA Sequence

TRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB2, Phosphorylated (S870) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (MaxLight 650)
MBS6429034-01 0.1 mL

NFKB2, Phosphorylated (S870) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (MaxLight 650)

Sign In for Pricing
View Details
NFKB2, Phosphorylated (S870) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (MaxLight 650)
MBS6429034-02 5x 0.1 mL

NFKB2, Phosphorylated (S870) (Nuclear Factor kappa B, p52, p105, H2TF1, LYT10, CVID10, LYT-10, NF-kB2) (MaxLight 650)

Sign In for Pricing
View Details
8- (6-Aminohexyl) -amino-adenosine-2',5'-bisphosphate-ATTO-Rho14
orb64531 40 µL

8- (6-Aminohexyl) -amino-adenosine-2',5'-bisphosphate-ATTO-Rho14

Sign In for Pricing
View Details
KLHL31 Polyclonal Antibody, PE-Cy7 Conjugated
bs-8057R-PE-Cy7 100 µL

KLHL31 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ABCD2, CT (ABCD2, ALD1, ALDL1, ALDR, ALDRP, ATP-binding cassette sub-family D member 2, Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein) (FITC)
MBS6270477-01 0.2 mL

ABCD2, CT (ABCD2, ALD1, ALDL1, ALDR, ALDRP, ATP-binding cassette sub-family D member 2, Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein) (FITC)

Sign In for Pricing
View Details
ABCD2, CT (ABCD2, ALD1, ALDL1, ALDR, ALDRP, ATP-binding cassette sub-family D member 2, Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein) (FITC)
MBS6270477-02 5x 0.2 mL

ABCD2, CT (ABCD2, ALD1, ALDL1, ALDR, ALDRP, ATP-binding cassette sub-family D member 2, Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein) (FITC)

Sign In for Pricing
View Details