Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYSLTR2 Rabbit pAb (APR23154N)

Product Specifications

Background

The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYSLTR2 Rabbit pAb (APR23154N) .

Synonyms

CYSLTR2; CYSLT2; CYSLT2R; GPCR21; HG57; HPN321; KPG_011; PSEC0146; hGPCR21

Gene ID

57105

UniProt

Q9NS75

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57105

Uniprot URL

https://www.uniprot.org/uniprot/Q9NS75

AA Sequence

TMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC11A Antibody
CSB-PA005515GA01HU 100 µL

CLEC11A Antibody

Sign In for Pricing
View Details
Human cytokeratin 5 (KRT5, KRT5) ELISA Kit
MBS167990-01 48 Well

Human cytokeratin 5 (KRT5, KRT5) ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 5 (KRT5, KRT5) ELISA Kit
MBS167990-02 96 Well

Human cytokeratin 5 (KRT5, KRT5) ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 5 (KRT5, KRT5) ELISA Kit
MBS167990-03 5x 96 Well

Human cytokeratin 5 (KRT5, KRT5) ELISA Kit

Sign In for Pricing
View Details
Human cytokeratin 5 (KRT5, KRT5) ELISA Kit
MBS167990-04 10x 96 Well

Human cytokeratin 5 (KRT5, KRT5) ELISA Kit

Sign In for Pricing
View Details
LCN10 siRNA (Human)
CRJ8212-01 15 nmol

LCN10 siRNA (Human)

Sign In for Pricing
View Details